PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1363s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 353aa    MW: 39058.3 Da    PI: 9.1987
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1363s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.77.3e-56281551128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+++yL++k+++ ++++ ++i +vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tg
  SapurV1A.1363s0020.1.p  28 LPPGFRFHPTDEELITHYLQNKISDADFSC-RAIGDVDLNKCEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTG 113
                             79****************************.89***************99999********************************** PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             kdke++++ + +l+g+kktLvfy+grap+gekt+Wvmheyr+
  SapurV1A.1363s0020.1.p 114 KDKEIFNSvTLQLIGMKKTLVFYRGRAPRGEKTNWVMHEYRV 155
                             ******9878889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-6425177IPR003441NAC domain
PROSITE profilePS5100560.41328177IPR003441NAC domain
PfamPF023653.2E-2929155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MQKPTGDKGK KQVEKEKEME GDAKEETLPP GFRFHPTDEE LITHYLQNKI SDADFSCRAI  60
GDVDLNKCEP WDLPGKAKMG EKEWYFFSLR DRKYPTGVRT NRATNTGYWK TTGKDKEIFN  120
SVTLQLIGMK KTLVFYRGRA PRGEKTNWVM HEYRVHAKAA FRASKQDEWV VCRIFQKSAG  180
PKKYPPNQSR TGNPFYNLEI GPSVMPPQMM QAAADNFQLP IGRNYMMSNA ELQAELTRVF  240
RAGGSAGINL PMQSPLNNSY SVGGGGGGGG GCFTVSGLNL NLGGATSQPV MRPMPPPAMN  300
QQDATPSMMA SAGSFAVEQA GYGAEMNGAN GHSNRFMGMQ QCMDLENYWP PY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-572718316171NO APICAL MERISTEM PROTEIN
1ut4_B4e-572718316171NO APICAL MERISTEM PROTEIN
1ut7_A4e-572718316171NO APICAL MERISTEM PROTEIN
1ut7_B4e-572718316171NO APICAL MERISTEM PROTEIN
3swm_A6e-572718319174NAC domain-containing protein 19
3swm_B6e-572718319174NAC domain-containing protein 19
3swm_C6e-572718319174NAC domain-containing protein 19
3swm_D6e-572718319174NAC domain-containing protein 19
3swp_A6e-572718319174NAC domain-containing protein 19
3swp_B6e-572718319174NAC domain-containing protein 19
3swp_C6e-572718319174NAC domain-containing protein 19
3swp_D6e-572718319174NAC domain-containing protein 19
4dul_A4e-572718316171NAC domain-containing protein 19
4dul_B4e-572718316171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011045041.10.0PREDICTED: NAC domain-containing protein 100-like isoform X1
TrEMBLU5FFA70.0U5FFA7_POPTR; Uncharacterized protein
STRINGPOPTR_0018s03910.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50733253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-118NAC domain containing protein 38